PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10014493m
Common NameEUTSA_v10014493mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 28550.3 Da    PI: 8.8008
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10014493mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81.1e-31959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Thhalv10014493m  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                     79***********************************************96 PP

2K-box97.91.5e-3278173499
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                       + +++ +++ e++++e+ kLk ++enLqr+qR+llGedL++L+ keL+qLe+qL+ slk++Rs K++++l+q+++lq ke++l e+n+aL++k
  Thhalv10014493m  78 IEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQSKEQMLLETNRALSMK 171
                      56667788999**********************************************************************************9 PP

            K-box  98 le 99 
                      l+
  Thhalv10014493m 172 LD 173
                      87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
CDDcd002651.94E-45277No hitNo description
SuperFamilySSF554553.14E-34280IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-2585172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.8288178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SNMIKTLDRY QKCSYGSIEV NNKPAKELEN SYREYLKLKG RYENLQRQQR NLLGEDLGPL  120
NSKELEQLER QLDGSLKQVR SIKTQYMLDQ LSDLQSKEQM LLETNRALSM KLDDMIGVRS  180
HHMGGGGWEG NEQNVSYAHH QAQSQGLYQP LECNATLQIG YDNPVGSEQI TATTQAQAQH  240
GNGYIPGWML *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D2e-35751741103Developmental protein SEPALLATA 3
4ox0_C2e-35751741103Developmental protein SEPALLATA 3
4ox0_B2e-35751741103Developmental protein SEPALLATA 3
4ox0_A2e-35751741103Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00092SELEXTransfer from AT5G15800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186080.0AK118608.1 Arabidopsis thaliana At5g15800 mRNA for putative transcription factor (AGL2), complete cds, clone: RAFL19-86-A21.
GenBankBT0062240.0BT006224.1 Arabidopsis thaliana At5g15800 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400104.10.0hypothetical protein EUTSA_v10014493mg
SwissprotP293821e-163SEP1_ARATH; Developmental protein SEPALLATA 1
TrEMBLV4LGN90.0V4LGN9_EUTSA; Uncharacterized protein
STRINGBra008674.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32892765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.11e-163MIKC_MADS family protein